SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404380.Gbem_1159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404380.Gbem_1159
Domain Number 1 Region: 345-371
Classification Level Classification E-value
Superfamily Fibritin 0.00000314
Family Fibritin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 404380.Gbem_1159
Sequence length 385
Comment (Geobacter bemidjiensis Bem)
Sequence
MRRLLFALNLSALLLALLVAPALAAPADQAERKLQGAPVSLKHAELMALRNQGGFVPGQW
YRIADFRTRWRSYITGIVHEAPVEPLLVQAITSNRLAILAYSERYPNDEIDYLIYDGSLH
GEIVNGVEIPSNDRGGIVRRKDINRGIECWFDFRAYTVRLFETAPGSGVYRDYGKGPAYV
DRPLLQVDNSSQVVIKKAGIPWRGEDGAVADNMGYGNPEHYLEAANKVQIGMNSFNIKIY
GNEVTSALFGECTDDIVCEGSWRNSQMVGFNNTVNFGGTVETSFFMGGTEVAKVSGDVTR
SVFLPGVVHATFNGRLTECMVFSGVDSKSYDGDRRGEFIGQSAEAIGAVGDAPKDGKLYV
RQNGRWVELVTAAPALRQQNAKGRQ
Download sequence
Identical sequences B5EHG8
WP_012529591.1.31571 gi|197117547|ref|YP_002137974.1| 404380.Gbem_1159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]