SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_0030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_0030
Domain Number 1 Region: 273-436
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.81e-37
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 209-281
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000942
Family Homodimeric domain of signal transducing histidine kinase 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_0030
Sequence length 460
Comment (Anaeromyxobacter Fw109-5)
Sequence
MPSRPVAGFVAAITAIVLALAVYLAVAISRQANAARAAESTRAVLALERLDASMREAESS
HRGYLLDGSAAELARHERAVSEIRAHLAALTARAEREPALRARTEALVAGADAALATMRA
ERDARDGALVGGAPWHAVADPGLLDGMDRVRAGLVAVERDALERREQAWSGKTALGDAVF
LVANLALAAVLLFAATSVRRALAAHEARERERHVALEAQARMFGIVGHDLRTPLSAIEAG
ATLLSRRSLAPAEARTLARILASSRRMARMIGDLLDFTRVRDAGGIPLAPRATDLREVCR
PVVEEVRLRHGADAVALSLDGHLDGNWDPDRLQQAIGNLVSNALQHQPTGAPVRLRAIGD
HDAVCVEVENDGPPIPAEAARAIFEPFRRGDARQAGADGLGLGLFIVRTIVEAHGGNVEV
ASGPDRPTTFTVRLPRGRPRERHAWAGSGLKAPAPPFDAG
Download sequence
Identical sequences A7H6A4
gi|153002909|ref|YP_001377234.1| 404589.Anae109_0030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]