SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_1024 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_1024
Domain Number 1 Region: 291-491
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 6.15e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000786
Further Details:      
 
Domain Number 2 Region: 812-1014
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 6.15e-41
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000333
Further Details:      
 
Domain Number 3 Region: 140-182,268-324
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.66e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0032
Further Details:      
 
Domain Number 4 Region: 43-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.28e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0034
Further Details:      
 
Domain Number 5 Region: 184-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.01e-18
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00074
Further Details:      
 
Domain Number 6 Region: 554-648
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.25e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0083
Further Details:      
 
Domain Number 7 Region: 698-782
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 5.36e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00095
Further Details:      
 
Domain Number 8 Region: 649-696,783-830
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000759
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_1024
Sequence length 1037
Comment (Anaeromyxobacter Fw109-5)
Sequence
MRFTDLFIRRPVIAIVVSLVIVIAGLQAMRSLNARQYPRSENAQIIVTTSYVGANAELVR
GFITTPLERVISSADGVDYIESESKQNLSTIRARLRLNHDATRALSEISAKVDQVRGDLP
PEAEVPVLTVESADSEFASAYLSFSSDILKQNEITDYLVRVIQPRLSAIEGVQRADILGA
RTFAMRIWLKPDRMASLNVSPAQVREALARNNYQAAVGQTKGSLVQVNLTTNTDLRSVRE
FEQLPVREQDGAIVRLGDVASVVLGAEDYDAAVNFTGQTAVFIGVWALPNANSLDVIERV
RAEMDSLQKEIPSQIQGRVAFDATSYVRDAITEVERTLAETLLIVVIVIFLFLGSLRSVL
VPVVAIPVSLIGAVFLMQAFGFTVNLLTLLAIVLSVGLVVDDAIVVVENVERHLREGMKP
VDAAIRGARELVGPIIAMTITLAAVYTPIAFQGGLTGALFREFALTLSGAVAISGVVALT
LSPVMSAFLLRQGREERGLAGRINRGFDRLRATYSRHLDVGLRSRGAIYAAWIAVSALTL
LMFTQVPKELAPTEDQGYVFGVVNTPANSTLDQITPSTREVNRTVMAMPESEFTFQITFP
NGGFWGVVFEPWEKRDRTAFELLQEIQGRVSSIAGIQTFPILPPALPGGGQFPVEFVIAS
TAESAEILQFAKQLQERATASGMFAFPPLIDVKLDQPSSEIEIDREKVAELGLDLRTVGQ
DLGSALGGDYVNRFSIGGRSYKVIPQLVRSERLNPEQLKDIYVTGPAGQLVSLASIATLR
DTVTPRTLNRFQQLNAVKISGVAIRPLDQALGFLEDEASRILPEGYTLDYTGESRQLRTE
GDRFLPAFLLAVVLIFLVLAAQFNSFRDPFVILAGSVPLGMFGAVVMMFLKMPNPNLPFF
TDGWTTTLNVYSQVGLVTLIGLVSKNGILIVEFANKLQEQGHTKLDAVREAAATRLRPIL
MTSVATVLGHFPLTLVSGPGAEARNSIGLVLVAGMTIGTAFTLFFVPAIYLLIARDHRAD
QKSGARAPAAAPAASGG
Download sequence
Identical sequences A7H937
gi|153003892|ref|YP_001378217.1| 404589.Anae109_1024 WP_011985339.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]