SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_1538 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_1538
Domain Number 1 Region: 203-363
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-37
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 136-212
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000334
Family Homodimeric domain of signal transducing histidine kinase 0.0025
Further Details:      
 
Domain Number 3 Region: 5-85
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000121
Family Heme-binding PAS domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_1538
Sequence length 394
Comment (Anaeromyxobacter Fw109-5)
Sequence
MIATFRAIAQLLPDPLLLLSRAGTVIAANAAAGERLGAPVAALVGRPLAELLGDPALPAF
LARCVRSSGPLPGAFTFAGRGERVRCEGARLPGADALVMLRLLGRERQGIFALLSEKVEA
LNREVLQRREAEDQRERLISELNRTVRLSETFVAVLGHDLRNPLGAVVAGATLALRRSDD
PKVRGHLERVLRSARRMARMVEQLLDVSRVRLGRGIPIVRDASDLCELVRQAAAETEPTH
RQHRFELRLPPRCEGEWDRDRLAQVLTNLLANACEHSEPGSVVTVALEDGPERAMVTVHN
PGPPIPPELLPSVFDAFASGSEDGRGLGLGLYIAREIALAHGGDISVDSADGRGTTFSVT
LPLRAAGGGAQHTKTPLPQILDEPPVPGRVGGTR
Download sequence
Identical sequences A7HAJ8
gi|153004403|ref|YP_001378728.1| 404589.Anae109_1538 WP_011985850.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]