SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_2142 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_2142
Domain Number 1 Region: 323-486
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.98e-45
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 255-335
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000334
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 
Domain Number 3 Region: 126-259
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000075
Family Heme-binding PAS domain 0.083
Further Details:      
 
Weak hits

Sequence:  404589.Anae109_2142
Domain Number - Region: 25-125
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.00249
Family Multidrug efflux transporter AcrB transmembrane domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_2142
Sequence length 502
Comment (Anaeromyxobacter Fw109-5)
Sequence
MAERFRIPAPPRLPPLAASAVAIGLPLLMFALDSVFRVLLEGVPFVLFLLAVALASWVGG
LVPGLVSVALSAALGYAFLRGSADPATVSGAHLAIAVFIPAAAVITAIGAAARAGFRERE
RVAETLRRSEARERAKAEELQAIMDAVPAAVLIAHDPDARTLTGSRAAYDLLRVPPGVNV
SKSGERPPVHYRVMRNGKELSPQELPTQVAARSGARARDVEFEIVFDDGTRRTLLGNAEP
LFDDQGRSRGAVSAFVDVTKLSEAVRTRDAFLSMASHELKTPITSLQLQVGSLLRAREGV
PAPVAKAADATRRQVVRLTSLVNTLLDVSRLNEGRLQLEIEPVDLSALVSEVASRFVAET
ERSESRIRVDAAEAVCGRWDRLRLEQVLTNLLSNALKYGEGKPVSVRVQSDGATARLAVV
DHGIGIAPSEQRRIFERFERGPATRGYGGFGLGLWITREIVSALGGTIHVESAPGAGSTF
RVELPVTGPAAGASASERGDPA
Download sequence
Identical sequences A7HC98
gi|153005003|ref|YP_001379328.1| 404589.Anae109_2142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]