SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_3046 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_3046
Domain Number 1 Region: 132-247
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000000000000471
Family Sensory domain of two-component sensor kinase 0.012
Further Details:      
 
Domain Number 2 Region: 530-628
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000401
Family N-terminal PAS domain of Pas kinase 0.08
Further Details:      
 
Domain Number 3 Region: 396-443
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000353
Family HAMP domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_3046
Sequence length 660
Comment (Anaeromyxobacter Fw109-5)
Sequence
MPHMRTPGLDLRRKILLVALLPTALLVAAFLVVFAVQRSRIAGRVEASMGRLAEEGLSRA
AHDLQTLCESAHRELWLQVPRSLRVARDQMERLGPLSFSSETVRWSAVNQLDRSAAEVVL
PKLLLGGEWAGQNADPARPSLLVDRVRELVGAEATLFQRMNERGDMLRVATTVPDEKGAR
AIGTYIPAVDPDGGANPVVSTVLRGETYRGRARVIDRWYLSGYEPIRDASGRIAGMLFIG
LRQDSLEGIRAGVAASRIGQTGAIHVLGASGNQRGKYLIPPPGHADGEDAWEARDARGEE
YVQRVLRAAKEAEGGTVRLSYALRDGAGAPRERVAAVTYFAPWDWVIVAEMDRSEAVAAL
REVQSSLAASAVTVVGVGLLLLLASIWAARKAASRLAAPLEAMALAAERIAEGDVQQEVT
YRSGDEVGRLAEAFRGTIRYIQEVARGAAAVARGDLSTPLVLRSDRDELTRSFQSAQSEL
RRLVEDAGALSQAAVEGRLTVRADPSRHQGDFRKVVEGVNATLSSLVGHLDAMPAPAMIV
GTEFDIRYMNQTGASLLGRTQQELIGTKCYDSFRTGDCRTGRCAGGRAMAEGREVSSETE
AHPEGLDLEIFYSAVPLRDGDGRVVGALEVVTDQTALRRGAAEDGGGRSEGPECRPCLVR
Download sequence
Identical sequences A7HEU7
gi|153005902|ref|YP_001380227.1| 404589.Anae109_3046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]