SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_3145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_3145
Domain Number 1 Region: 191-295
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000144
Family Heme-binding PAS domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_3145
Sequence length 316
Comment (Anaeromyxobacter Fw109-5)
Sequence
MSQTWRELLMTDHETTERVFSAAEKALAAPEGPSPGMVANLREYLVGYVDRCHNQKEEQT
VFPLLQRAGLPVEGGPLAVMLAEHRQAKALVERIDGAAAAFVAGDRARLDDLRDAFGAYA
ALCKDHFWKENDILYPLAARMLDEATQAGIVPGIEAVEAALGPDTRRRYYRIADELVRAV
ELEDLSYGLDRQVLAAILNTLPVELSFVDEEDRVRYFSHERGEKIFPRSRGAIATNVRNC
HPQKSVHLVEKILADFKAGRREVAEFWIDMGPRKVHIRYWPVRDEAGRYLGCLETVQDVS
GIQRLTGQRRLLEEAA
Download sequence
Identical sequences A7HF45
WP_012097958.1.20576 404589.Anae109_3145 gi|153006000|ref|YP_001380325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]