SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_3857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_3857
Domain Number 1 Region: 19-134
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.94e-28
Family Heme-binding PAS domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_3857
Sequence length 145
Comment (Anaeromyxobacter Fw109-5)
Sequence
MDDLGFEGIAARIVEETGDAILFADRDGVVRLWNRGAERMFGFSAAEAIGQSMDFIIPER
LRQRHWDGWKRVMETGVTRYGTEVLAVPALRKDGQTLSIEFTIQLIRDASGRILGPSAVI
RDVTARFKREKELRARLKELEARAG
Download sequence
Identical sequences A7HH40
404589.Anae109_3857 WP_012098670.1.20576 gi|153006695|ref|YP_001381020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]