SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_4112 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_4112
Domain Number 1 Region: 145-387
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.44e-70
Family Extended AAA-ATPase domain 0.00000178
Further Details:      
 
Domain Number 2 Region: 357-464
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000582
Family FIS-like 0.033
Further Details:      
 
Weak hits

Sequence:  404589.Anae109_4112
Domain Number - Region: 19-107
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0114
Family BphP N-terminal domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_4112
Sequence length 475
Comment (Anaeromyxobacter Fw109-5)
Sequence
MQAAPESTRDVAFAAVNAAFGSLGRICMALDSQFRIRHASERMESLLGAGAAGRIAGAPV
ETVLGTELFGTDGPLRQALLAGERREGWRAYLQCERGPRLLSVTAAPLEHDPHGVCDPSA
AYLVVLRPADDESPDVCAPVAGFGVMCRSQAMTRVFRLIETLQHSESTVLVTGESGTGKE
VMARIIHAHSPRRNGPFVAVNAAALPAELLESELFGHVRGAFTGAIRDRLGRFEAAEGGT
LFLDEVGDLPLPVQVKLLRVLQEHTYERVGDDAERRTSARIIAATHRDLRRAVAAGTFRE
DLYYRLRVFPVELPPLRARREDIEPIARVLLGRVGARTARALRFSPDALRVLLSYDWPGN
VRELENALEYAATVCQGQTLQPEDLPPEIVAGAPHREPLAAPLAAGSSTPAQLAAAAARR
ASPHDERASLQAALDAHRWNRADTAKALGLSRSTLWRRMRALGLLEPAEGAQAAG
Download sequence
Identical sequences A7HHU4
404589.Anae109_4112 WP_012098929.1.20576 gi|153006949|ref|YP_001381274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]