SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_4264 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_4264
Domain Number 1 Region: 846-1080
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.7e-40
Family Multidrug efflux transporter AcrB transmembrane domain 0.00061
Further Details:      
 
Domain Number 2 Region: 292-498
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.89e-38
Family Multidrug efflux transporter AcrB transmembrane domain 0.00047
Further Details:      
 
Domain Number 3 Region: 136-183,269-326
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.86e-21
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0037
Further Details:      
 
Domain Number 4 Region: 48-126
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.28e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0043
Further Details:      
 
Domain Number 5 Region: 184-267
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.05e-16
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0045
Further Details:      
 
Domain Number 6 Region: 761-844
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000124
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_4264
Sequence length 1092
Comment (Anaeromyxobacter Fw109-5)
Sequence
MIKAIIRFSAENKYLVVAATLVALLGSAWAMRHIPLDAVPDLSDTQVIVYSKWDRSPDIV
EDQVTYPITTALLGAPKVKAIRGFSDFGFSYVYVIFEDGTDMYWARTRVLEYLSKITPQL
PQGVTTELGPDATSVGWVYQYALVDRTGRHSSDELRSFQDWFLRYAVQSVPGVSEVATVG
GQVRQYQITVNPNALATYKLPLDAVVNAVRTGNNDVGGRLVEFSGREYMVRGRGYVKSIA
DLENLVLRSEGGTPVLVKDVATVALGPEMRRGVADLDGEGDVVGGIVVMRHGENALNVIE
RIEAKLEEVKPSLPEGVELVTTYDRSELIEEAISTVKHKLVEEIIVVSIIILVFLWHIPS
AIIPIITIPVSVALSFIPMYFMGINANLMSLAGIAISIGVLVDGAIVEVENAYNKIHHWL
KDGRKGDFHHVRLEALLEVGPGVFFSLLVIAVAFMPVFTLVDQEGRLFRPLAFSKNLAMA
IAAFLAITLDPAMRMMFARIDDFTFKPRWLAWLANKALVGTYYSEEAHPISRALHRVYEP
PCRFVLRHPRATILASVLLVVTTIPVYLSLGSEFMPQLREGTILYMPSAVEPGMSVAEAQ
QALQVQDKLLKTFPEVERVFGKAGRANTSTDPAPFTMMETTLILKPQSEWREKPRWYSSW
APDWLKAVLRPIWNDRISHEELENEMDAALQLPGISNAWTMPIKGRLDMLSTGIRTPIGI
KISGADLKTIEQIAKETEAVVKKVPGTRSVYAERVAGGYFLDFVLKREQLARYGLTVDDA
NMMVMTAVGGDNQSTTVEGRERYGINVRYARDYREDLSALRRVLLPLPSGQGQIPMEEIA
DVVLAQGPAMIRNENGLLSGYVYVDFDTSKIDVGGYVDEAKKAVAAGVDLPTGYNMSWSG
QYENMLRVKERLKLIIPITLVLIFGLLYMNTKSSFKAALVMAAVPFSAVGAVWLLWALDY
NVSIAVWVGIIALMGLDAETGVFMLLFLDLSHDEYKAKGLLRTRGDLVEAIVHGAVKRVR
PKAMTVFAAMLGLLPIMWSIGTGADVMKRIAAPMIGGLVTSFVMELLVYPPVYYLWKKKE
VSDEDTMTAIAA
Download sequence
Identical sequences A7HI96
404589.Anae109_4264 gi|153007101|ref|YP_001381426.1| WP_012099086.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]