SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_4457 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_4457
Domain Number 1 Region: 498-657
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.58e-40
Family Histidine kinase 0.0031
Further Details:      
 
Domain Number 2 Region: 309-417
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000119
Family Heme-binding PAS domain 0.046
Further Details:      
 
Domain Number 3 Region: 427-505
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000275
Family Homodimeric domain of signal transducing histidine kinase 0.0048
Further Details:      
 
Domain Number 4 Region: 149-305
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000224
Family GAF domain 0.011
Further Details:      
 
Domain Number 5 Region: 37-93
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000366
Family Heme-binding PAS domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_4457
Sequence length 661
Comment (Anaeromyxobacter Fw109-5)
Sequence
MARKESGRPRASSTRAAPGRKPAAPRRRPAPRRAPPAAEAVMSEVFRTAPAPSAVIADGV
VVLANEAFARALGRDAGELRGALLRELLPPAGGELPMPEPGALRSYRTAVAGVPARVDLS
SALAPGSAAVLGCAALTLALPDEDTAPSRALLALSRELAEARTEDQITAAVARALEVLFP
ARSFCIRLLDPKTFALTTLYARGRLRPLARGRLALKAIAVERTGLSRAALELGGVQVVER
DEPLFDGCDDATAVPLAVAGQLFGIVNLEYPRGGPGDPLSDATLLYQVANHAALGVRNLR
SVEELTYLKTYLEDLIEHANALIFVVSRAREVIVWNAALSRLTGVARDEALGRELAVRVP
SGEHAPLEDVLARGFGGEAVNGFETRLLAGAGREARIAVNTAPIYGAAGDVEGVIAIGQD
LTLVRSLQAAAEHAERLAGIGRLVAGVVHELNNPLTAVNMYSDVLVEKLQNAGHDPADVE
KLRAIREGGQRIQRLARDLVTYAKPSGARTEPLELASVLEEAARLAKPALKEPSAVLERR
FAPAPTVEGNRPSLVHVFVNLLRNAAQAVGEGGRVSLVLAQEGDAVKVEVRDDGSGMPPA
VAARAFEPFFTTRPGVGIGLGLPIVQGIVERHGGTVSLESAEGRGTTVTVRLPIHPPARA
E
Download sequence
Identical sequences A7HIT9
404589.Anae109_4457 gi|153007294|ref|YP_001381619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]