SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405531.BCG9842_B1680 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405531.BCG9842_B1680
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.31e-29
Family Collagen-binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 1.09e-23
Family PKD domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405531.BCG9842_B1680
Sequence length 971
Comment (Bacillus cereus G9842)
Sequence
MKGYSKKMLVGVSFASLMLGSFQGVSLAEDTKGEQVSYRNVLKMEPVGVQLPVQELAHSS
KLLESKSFEQRIQFADLSQRPPEVKKESKQLAVAKTYTIAELNQLSNQQLVDLLITIDWE
QITGLFQFNTDSLAFYQNDSRMQAIIDKLKQQGQAYTKDDSKGIETLVEVLRSGFYLGFY
NSELSKLNERSYHDKCLPALKAIANNSNFKLGTLEQNRVVSSYGKLIGNASSDVETITSA
AKIFKQYNDNFSTLVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPKDTVWYQKIDSYIN
ELSRFALMGTITAKNGWLINNGIYYTGRLGSFHSTGTKGLQVVTDAMKIYPYLGEQYFVA
AEQIATNYGGKDANGKVVNLDQIREDGKKKYLPKTYMFDDGAIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNPDDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKIYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGLSSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKIHDLIRKNDVTAYDAYRSTLSKDANLNKEYQDYMQMLFDNREKYNVPLVSDDYLA
NHAPKPVSDIAAEITAEAKLKNVSVKKNKSKFFNTFTLQGTYTGTAAKGEYEDWKIITQN
VNDTLKRLSAKEWTGYKTVTAYFVNYRVNASGQFEYDVVFHGINTEEGAENKAPVAVING
PYSGNVNEAISFKSDASKDEDGKITSYKWEFGDGTVSNEQNPTHVYTKEGAYTAKLTVTD
DKGATNTATATVTVQKKEDNSLEKEPNNSFQTANKLQLNQVLRASLGNGDTSDFFEINVE
TAKNLQINVTNENNIGMNWVLYSEADLNNYVTYAQQQGNKLVGSYYTYPGKYYLHVYQYG
GGTGNYTVEVK
Download sequence
Identical sequences A0A1S7F8S7 B7IRH4
gi|218898620|ref|YP_002447031.1| 405531.BCG9842_B1680 WP_000679516.1.36279 WP_000679516.1.50042 WP_000679516.1.61799 WP_000679516.1.83666 WP_000679516.1.87649 WP_000679516.1.9703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]