SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405532.BCB4264_A0591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405532.BCB4264_A0591
Domain Number 1 Region: 855-964
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.31e-30
Family Collagen-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 733-850
Classification Level Classification E-value
Superfamily PKD domain 1.31e-18
Family PKD domain 0.0015
Further Details:      
 
Weak hits

Sequence:  405532.BCB4264_A0591
Domain Number - Region: 622-679
Classification Level Classification E-value
Superfamily Bacteriocin immunity protein-like 0.0366
Family EntA-Im 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405532.BCB4264_A0591
Sequence length 965
Comment (Bacillus cereus B4264)
Sequence
MNKKSKINKVMLSISTMALSLGALQTHAAAEEKVPYNVLKTKPVGIEKSVDEVGHISKVD
ETLSFQERLKVGDFSQRPASITKKTAVKQVKESYSMADLNKMNDQELVETLGSIKWHQIT
DLFQFNEDAKAFYKDKGKMQVIIDELAHRGSTFTKDDSRGIQTFTEVLRSAFYLAFYNSE
LSDLNERSFQDKCLPALKAIAKNPNFKLGTVEQDTVVSAYGKLISNASSDVETVQYASNI
LKQYNDNYTTYVNDRMKGQAIYDIMQGIDYDMQSYLTEARKEANETMWYGKVDGFINEIN
RIALLNEVTPENKWLVNNGIYFASRLGKFHSNPNKGLEVVTQAMHMYPRLSEPYFVAVEQ
ITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGSIVFKTGDKVSEEKIKRLYWAA
KEVKAQYHRVIGNDKALEPGNADDVLTIVIYNSPDEYQLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGRGDMYQNERLTWFQEGNAEFFA
GSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKYGSWDFYNYSFALQSYLYTHQFETF
DKIQDLIRANDVKNYDAYRENLSKDPKLNKEYQEYMQQLIDNQDKYNVPEVADDYLAEHA
PKSLTEVKKEISDTLPMKDTKMTKHNSQFFNTFTLEGTYTGSVTKGESEDWKAMSKRVNE
SLEQLAQKEWSGYKTVTAYFVNYRVNSSNEFEYDVVFHGIAKDDGENKAPTVNINGPYSG
LVKEGIQFKSDGSNDEDGKIVSYLWEFGDGSTSVEVNPVHVYEREGSYKVSLRVKDDKGK
ESRSETTVTIKDGSLTESEPNNRPEEANRIGLNSTIKGNLIGGDHTDVYTFNVASAKDID
ISVLNEYGIGMTWVLHHESDMQNYAAYGQANGNHIEAKFNAKPGKYYLYVYKYDNGDGTY
SLSVK
Download sequence
Identical sequences A0A0J7C6C4 B7H9W3
gi|218231943|ref|YP_002365351.1| WP_001036421.1.67873 WP_001036421.1.76086 WP_001036421.1.85348 405532.BCB4264_A0591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]