SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405532.BCB4264_A3636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405532.BCB4264_A3636
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.57e-29
Family Collagen-binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 1.11e-23
Family PKD domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405532.BCB4264_A3636
Sequence length 971
Comment (Bacillus cereus B4264)
Sequence
MKGYSKKMLVGVSFASLMLGSFQGVSLAEDTKGEQVSYRNVLKMEPVGVQLPVQELAHSS
KVLESKSFEKRLQFADLSQRPPEVKKESKQLAVAKTYTIAELNQLSNQQLVDLLVTIDWE
QITGLFQFNTDSLAFYQNDSRMQAIIDKLKQQGQAYTKDDSKGIETLVEVLRSGFYLGFY
NSELSKLNERSYHDKCLPALKAMANNPNFKLGTLEQNRVVSSYGKLIGNASSDVETITSA
AKIFKQYNDNFSTLVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPKDTVWYQKIDSYIN
ELSRFALMGTITAKNGWLINNGIYYTGRLGMFHSTGTKGLQVVTDAMKMYPYLGEQYFVA
AEQIATNYGGKDANGKVVNLDQIREDGKKKYLPKTYTFDDGAIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNPDDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKIYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGLSSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKIHDLIRKNDVTAYDAYRSTLSKDANLNKEYQDYMQMLVDNREKYNVPLVSDDYLA
NHASKPVSDIAAEITAEAKLKNVSVKKNKSQFFNTFTLQGTYTGTAAKGEYEDWKTITQN
VNDTLKRLSAKEWTGYKTVTAYFVNYRVNTSGQFEYDVVFHGINTEEGAENKAPVAVING
PYSGNVNEAISFTSDGSKDEDGKITSYKWEFGDGAVSNEQNPTHVYTKEGTYTTKLTVTD
DKGATNTATATVTVQKKEDNSVEKEPNNSFQTANKLQLNQVLRASLGNGDTSDFFEINVE
TAKNLQINVTNENNIGMNWVLYSEADLNNYVTYAQQQGNKLVGSYYTYPGKYYLHVYQYG
GGTGNYTVEVK
Download sequence
Identical sequences B7HAQ0
405532.BCB4264_A3636 gi|218233315|ref|YP_002368340.1| WP_000679521.1.76086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]