SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405532.BCB4264_A3861 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405532.BCB4264_A3861
Domain Number 1 Region: 180-468
Classification Level Classification E-value
Superfamily Subtilisin-like 8.12e-37
Family Subtilases 0.00047
Further Details:      
 
Domain Number 2 Region: 503-612
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.44e-32
Family Collagen-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405532.BCB4264_A3861
Sequence length 613
Comment (Bacillus cereus B4264)
Sequence
MKIFQKMCASTVMITALLGTGGTINSVHADSIEQQIKSGIEQETDKQIIVKFKADLDLPY
EDGIEKQIQSQTNDKVIKDLLTEYPDVTFTRLFTSVSPEQIQNLEVKAPNHVSTSLLNYY
ILQNQNSGYEEEIVDKLKASSLIEDAYMKRKEKIMPPEVQSSSVALNPSNNPRFKKQGYL
EAAPYGINAPFAWEIQGGNGNGITFVDMEYGWLLNHEDLLHQNIELMSGRNIDQHVGHGT
SVLGIVSSEDNEVGNIGIAPKAKAKVISQIRDNGQYNTADAILSAVNQLEAGDVLLLEAQ
ASFDGYGDKYLPVEVQPDIFDAIRAGTDKGIVIIEAGANGWNDLDQFKDRKGKQVLNRNS
KDFKDSGAIMVGAGSSSFPHERMWFSNYGSRIDVYGWGENVDTTTAEQSRSAVNLYTSSF
SGTSSASPIIAGAATLVQSIAKENLGQPYRPSELRAILSNQSTGTKSKDPYADKIGVLPD
LKSILVNLGYEQRKPNGGNELQVTENEPNNDPRQANKVNFHTPVKGTLHNSDRVDVFTFQ
IDSPENINISLLNEQNIGMTWVLHHESDLNNYVAYGENEGNVVKGTYNAKPGKYYLYVYK
YENKDGSYVLNIK
Download sequence
Identical sequences B7HDN7
gi|218231877|ref|YP_002368565.1| 405532.BCB4264_A3861 WP_000689205.1.14039 WP_000689205.1.7593 WP_000689205.1.76086 WP_000689205.1.81773 WP_000689205.1.97670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]