SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405534.BCAH187_A3542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405534.BCAH187_A3542
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.54e-29
Family Collagen-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 1.96e-22
Family PKD domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 405534.BCAH187_A3542
Sequence length 971
Comment (Bacillus cereus AH187)
Sequence
MKGYSKKVLVGVSFASFMLGSFQGDALAEGTKGEQVSYRNVLKMEPIGLQLPVQELAHSS
KVLENKSFEKRLKFADLSQRPPEVKKESKQLAVAKTYTIAELNQLSNQQLVDLLVTIDWE
QITGLFQFNKDSLAFYQNDSRMQAIIDKLNQQGQAYTKDDSKGIETLVEVLRSGFYLGFY
HTELSKLNERSYHDKCLPALKTIANNSNFKLGTLEQNRVVSSYGKLIGNASSDVETITSA
AKIFKQYNDNFSTLVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPEDTIWYQKIDSYIN
ELSRFALIGTVTAKNGWLINNGIYYTGRLGTFHSTETKGLQVVTDAMKIYPYLGEQYFVA
AEQIATNYGGKDANGKVVDLDQIREDGKKKYLPKTYTFDDGAIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNPDDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKMYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGISSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKIHDLIRKNDVTAYDAYRSALSKDANLNKEYQDYMQMLVDNREKYNVPLVSDDYLA
THAPKPVSDIAAEITAEAKLSNVSVKKNKSQFFHTFTLQGTYTGTTAKGEYEDWKTITQN
VNDTLKRLSAKEWTGYKTVTAYFVNYRVNAAGQFEYDVVFHGINTEEGAVNKAPVAVING
PYSGNVNAAISFKSDGSKDEDGKIVAYKWEFGDGTVSNKQNPTHVYTKEGTYTAKLTVTD
DKGLTNTATTNVTVQKKEDNSVEKEPNNSFQTANKLQFNQVLRASLGNGDTSDYFEINVE
TAKNLQINVTKENNIGVNWVLYSEADLNNYVTYAQQEGNKLVGSYYTYPGKYYLHVYQYG
GGTGNYTVEVK
Download sequence
Identical sequences B7HZW5
gi|217960918|ref|YP_002339486.1| 405534.BCAH187_A3542 WP_000679535.1.82986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]