SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405535.BCAH820_3538 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405535.BCAH820_3538
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.67e-28
Family Collagen-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 4.05e-23
Family PKD domain 0.00074
Further Details:      
 
Weak hits

Sequence:  405535.BCAH820_3538
Domain Number - Region: 187-296
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0506
Family 14-3-3 protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405535.BCAH820_3538
Sequence length 971
Comment (Bacillus cereus AH820)
Sequence
MKGYSKKVLVGVSFASLMLGSFQGGALAEGTKGEQASYRNVLKMEPVGVQLPVQELAHSS
KVLENKSFEKRLQFADLSQRPPELKKESKQLATAKTYTIAELNQLSNQQLVDLLVTIDWE
QITGLFQFNKDSLAFYQNDSRMQAIIDKLNQQGQAYTKDDSKGIETLVEVLRSGFYLGFY
HTELSKLNERSYHDKCLPALKTIANNPNFKLGTLEQNRVVSSYGKLIGNASSDVETITSA
AKIFKQYNDNFSTWVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPKDTVWYQKIDSYIN
ELSRFALIGTVTEKNAWLINNGIYYTGRLGTFHSTGTKGLQVVTDAMKMYPYLGEQYFVA
AEQIATNYGGKDANGNVVNLDQIREDGKKKYLPKTYTFDDGTIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNADDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKIYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGISSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKVHDLIRKNDVTAYDAYRSALSKDANLNKEYQDYMQMLVDNRDKYNVPLVSDDYLA
THAPKPVSDIVAEITAEAKLSNVSVKKNKSQFFNTFTLQGTYTGTTAKGEYEDWKSITQN
VNDTLKRLSVKEWTGYKTVTAYFVNYRVNASGQFEYDVVFHGINTEEGAVNKAPVAVING
PYSGNVNEAISFKSDGSKDEDGKIVAYKWEFGDGTVSNEQNPTHVYTKEGTYTARLTVTD
DKGLTNTVTTNVTVQKKEDNSVEKEPNNSFQTANTLQFNQVLRASLGNGDTSDFFEINVE
TAKNLQINVTKENNIGVNWVLYSEADLNNYITYAQQEGNKLVGSYYTYPGKYYLHVYQYG
GGFGNYTVEVK
Download sequence
Identical sequences B7JH86
gi|218904654|ref|YP_002452488.1| 405535.BCAH820_3538 WP_000679560.1.7545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]