SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 410358.Mlab_1485 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410358.Mlab_1485
Domain Number 1 Region: 55-100
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0000785
Family Zn-finger domain of Sec23/24 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 410358.Mlab_1485
Sequence length 106
Comment (Methanocorpusculum labreanum Z)
Sequence
MAKAEKGVSAKKIAQERVDILFERAKEARDEPELSARYVSLAREMAMKQRVRLAHYHRRS
FCPSCHAYFIPGTNLRVRIQHGKIIYTCGICGAVTRIPLNKKTESR
Download sequence
Identical sequences A2STJ3
410358.Mlab_1485 WP_011833852.1.86236 gi|124486300|ref|YP_001030916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]