SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 412418.BRE_2045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412418.BRE_2045
Domain Number 1 Region: 59-356
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 2.88e-83
Family Variable surface antigen VlsE 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 412418.BRE_2045
Sequence length 364
Comment (Borrelia recurrentis A1)
Sequence
MKEKKGKGNIEESISEYREKGREKRSKRGLKGIMVLVMVMMGCNSGGVSGGVKDPEKVFL
SEMVNLGKGFLDVFVSFGDMITGTLGIKADTKKSDIGKYFTDIEKTMISVKEKLQTEVAK
NGNYVKIKEVVDQFITGTLDKIAEGAKKASSGAAGGAVLGSSVKNEDAAPGEVASVNALI
EGIKTIVAVVLKNEGNADANKTTDDDKKDIGKLFSKASDNGSEAEAAKANASIGAVSGVD
ILQAIAKSDVVSAAGKDIDQAKDVAEIATAKNDSGTKETKQKDAVISGGIALRSMAKGGK
FATKNEDKAVPAINGVAASAVGKTLSALIIAIRNTVDSELKKINEVLATVKQEDKSSEAT
ASVQ
Download sequence
Identical sequences B5RS85
WP_012539703.1.6979 gi|203288432|ref|YP_002223783.1| gi|203288461|ref|YP_002223823.1| 412418.BRE_2045 412418.BRE_3020 gi|203288432|ref|YP_002223783.1|NC_011258 gi|203288461|ref|YP_002223823.1|NC_011260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]