SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 412418.BRE_4033 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412418.BRE_4033
Domain Number 1 Region: 77-370
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 6.67e-47
Family Variable surface antigen VlsE 0.0000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 412418.BRE_4033
Sequence length 378
Comment (Borrelia recurrentis A1)
Sequence
MYVLYKSYFFASNPSKKSYKKAKKKKNKEAKRMKKGIKGEMINIVMIMCLMVVMGCNSGG
VKGEEGKGTQGIGGLGEVISHLREGFLEVFVSFGNILKDTFGLTSNTTKKEVGERLGKIG
EAVEVAKGKLEGIKGTEQFSLMKDKVDSVITNAVNILKKLVEGTKKFKEATDGANGKIGN
ANGTEDAVQADIASVKSLVEGINMIYEAAKEVKVDSKGNADKTIADSKAIAKLFNDTASA
DATGLKAANVALNSSSGADILAVIDSAKNGINAPAGQISAAKNAYDIAVAIKNSADAGAD
VREKGSVITAGLALRAMAKNGKLATHANVPAEGLNAVLIGAVSKTVNEIVSTIRRTVDKC
LKDVNDCIKEDFSSVVKS
Download sequence
Identical sequences B5RS68
gi|203288414|ref|YP_002223700.1| WP_012539622.1.6979 gi|203288414|ref|YP_002223700.1|NC_011255 412418.BRE_4033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]