SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 412694.BALH_0495 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412694.BALH_0495
Domain Number 1 Region: 855-964
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.8e-31
Family Collagen-binding domain 0.0000913
Further Details:      
 
Domain Number 2 Region: 733-850
Classification Level Classification E-value
Superfamily PKD domain 4.32e-18
Family PKD domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 412694.BALH_0495
Sequence length 965
Comment (Bacillus thuringiensis Al Hakam)
Sequence
MNKKSKINKVMLSISTMALSLGALQAPVLAEEKVPYNVLKTKPVGIEKPVDEIGHVSKAE
ETLSFQERLKVGDFSQRPASITNKAAVKQVKESYSMADLNKMNNQELVETLGSIKWHQIT
DLFQFNEDAKAFYKDKGKMQVVIDELAHRGSTFTKDDSKGIQTFTEVLRSAFYLAFYNNE
LSELNERSFQDKCLPALKAIAKNPNFKLGTAEQDTVVSAYGKLISNASSDVETVQYASNI
LKQYNDNFTTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARKEANETMWYGKVDGFINEIN
RIALLNEVTQENKWLVNNGIYFASRLGKFHSNPNKGLEVVTQAMHMYPRLSEPYFVAVEQ
ITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGSIVFKTGDKVSEEKIKRLYWAA
KEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGRGDMYQNERLTWFQEGNAEFFA
GSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKYGSWDFYNYSFALQSYLYTHQFETF
DKIQDLIRANDVKNYDAYRENLSKDLKLNEEYQEYMQQLIDNQDKYNVPEVADDYLAEHA
PKSLTAVEKEITETLPMKDAKMTKHSSQFFNTFTLEGTYTGSVTKGESEDWNAMSKKVNE
ALEQLAQKEWSGYKTVTAYFVNYRVNSSNQFEYDVVFHGIAKDDEENKAPTVHINGPYNG
LVKEGIQFKSDGSKDEDGKIVSYLWDFGDGSTSAEVNPLHVYEREGSYKVALIVKDDKGK
ESKSETTVTVKDGSLTESEPNNRPEEANRIGLNTTIKGSLIGGDHTDVYTFNVASAKNID
ISVLNEYGIGMTWVLHHESDMQNYAAYGQVNGNHIEANFNAKPGKYYLYVYKYDNGDGTY
ELSVK
Download sequence
Identical sequences A0R9J4
412694.BALH_0495 WP_001036393.1.13221 WP_001036393.1.23873 WP_001036393.1.24676 WP_001036393.1.33828 WP_001036393.1.46476 WP_001036393.1.782 gi|118476243|ref|YP_893394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]