SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 412694.BALH_2979 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412694.BALH_2979
Domain Number 1 Region: 133-177
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0000589
Family Surp module (SWAP domain) 0.0045
Further Details:      
 
Weak hits

Sequence:  412694.BALH_2979
Domain Number - Region: 85-186
Classification Level Classification E-value
Superfamily MAPEG domain-like 0.0628
Family MAPEG domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 412694.BALH_2979
Sequence length 240
Comment (Bacillus thuringiensis Al Hakam)
Sequence
MKLVIPKQHGAWAMLVIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKE
YLHAAIVYFIIAFIFGMISLLYEWRILLFVAVMIPFFIVNMYYARQKNERALLNDISAII
VFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHI
VLTVIVFAINPLCSLIFIPSVIRAIILYGKKISIIKVGILEIVNSVYFLIITAVIMKYAI
Download sequence
Identical sequences A0RGA3
gi|118478602|ref|YP_895753.1| 412694.BALH_2979 WP_000779963.1.33828 WP_000779963.1.46476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]