SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 412694.BALH_3172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412694.BALH_3172
Domain Number 1 Region: 876-983
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.8e-28
Family Collagen-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 784-869
Classification Level Classification E-value
Superfamily PKD domain 3.53e-23
Family PKD domain 0.00066
Further Details:      
 
Weak hits

Sequence:  412694.BALH_3172
Domain Number - Region: 200-308
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0523
Family 14-3-3 protein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 412694.BALH_3172
Sequence length 984
Comment (Bacillus thuringiensis Al Hakam)
Sequence
MVRYTKKCKVGESMKGYSKKVLVGVSFASLMIGSFQGGALAEGTKGEQVSYRNVLKMEPV
GVQLPVQELAHSSKVLENKSFEKRLQFADLSQRPPEVKKESKQLAVAKTYTIAELNQLSN
QQLVDLLVTIDWEQITGLFQFNKDSLAFYQNDSRMQAIIDKLNQQGQAYTKDDSKGIETL
VEVLRSGFYLGFYHTELSKLNERSYHDKCLPALKTIANNPNFKLGTLEQNRVVSSYGKLI
GNASSDVETITSAAKIFKQYNDNFSTWVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPK
DTVWYQKIDSYINELSRFALIGTVTEKNGWLINNGIYYTGRLGTFHSTGTKGLQVVTDAM
KMYPYLGEQYFVAAEQIATNYGGKDANGNVVNLDQIREDGKKKYLPKTYTFDDGTIVLKA
GDKVTEEKVKRLYWAAKEVKAQFHRTVESDQPLEKGNADDVLTMVIYNSPAEYQFNRQLY
GYETNNGGLYIEGTGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKIYE
NERLSWFEEGNAEFFAGATRTDNVVPRKSIIGGISSNPAERYTAERTLNAKYGTWDFYNY
SFALQSYMYNKRYDMFDKVHDLIRKNDVTAYDAYRSALSKDANLNKEYQDYMQMLVDNRD
KYNVPLVSDDYLATHAPKPVSDIVAEITAEAKLSNVSVKKNKSQFFHTFTLQGTYTGTTA
KGEYEDWKSITQNVNDTLKRLSAKEWTGYKTVTAYFVNYRVNASGQFEYDVVFHGMNTEE
GAVNKAPVAVINGPYSGNVNEAISFKSDGSKDEDGKITSYKWEFGDGAVSNEQNPTHVYT
KEGTYTARLTVTDDKGLTNTVTTNVTVQKKEDNSVEKEPNNSFQTANTLQFNQVLRASLG
NGDTSDFFEINVETAKNLQINVTKENNIGVNWVLYSEADLNNYITYAQQEGNKLVGSYYT
YPGKYYLHVYQYGGGFGNYTVEVK
Download sequence
Identical sequences A0RGT1
412694.BALH_3172 gi|118478780|ref|YP_895931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]