SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 413999.CBO0379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413999.CBO0379
Domain Number 1 Region: 562-670
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000719
Family Collagen-binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 441-553
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000942
Family Collagen-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  413999.CBO0379
Domain Number - Region: 347-431
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000589
Family Collagen-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 413999.CBO0379
Sequence length 689
Comment (Clostridium botulinum A)
Sequence
MVKSKEKNKIFFTLLAITLIFIVNSNKVKANDEINFKRLDGKGRYETSSSICSGGWDTSE
YAVLASGEGFADALSAAPLAKKYDAPIILTGKNKLNDNAKDQLKKLDTKEVIIVGGPGSI
SEDIVTELKDLGIKVNRIYGEDRYKTSLKIAKEIGVKNGVVVTNGLGFADALAMAPIAAS
KQMPILLTPSDKLTSDTMEFLKKNSYNKSYILGGTATVSDYIKNSLKNPTRLSGADRYQT
NIAILNHFKEDLNLDEVYISSGDGYADALSGSVLASKNKSPIILINDNLNKSTKDFVSNN
KSNFKNVIIFGGEGVVKEPTISSLFGAFRSGETRSDTKEVSAEKWDRSYLKDYHIELPES
GKLDIEYDISNFTRFDLIVLDIKNNEIIKKSYNYLKNNKSIHDNYNDIRLPKGKYIVRVH
AFNMDGTYTIKAKYTQEGEGFEKESNNDIKTANVLEPNKSIIGSIHSYNDVDYYKFTLNE
KGSLKINLKHNQYGRYGFKVNLLDENNKSISQFISGGEDINSYSNKLRLPKGTYFVRIEC
EKWNDEPLQYELNLDYDIEGENYESEPNDYIQDANYIKCNKEYIGNIQSRDDRDYYKINL
NSDSKITINFKHDEGYGKWTIYLYDKDNKPIQRFKSYGYEINKDFDPIELEAGEYYVSVE
GRDSLDYTINVKREAPDKSNNENKKVKRR
Download sequence
Identical sequences A5HYS3
gi|148378382|ref|YP_001252923.1| 413999.CBO0379 YP_001252923.1.75347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]