SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 41431.PCC8801_2343 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41431.PCC8801_2343
Domain Number 1 Region: 9-317
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00013
Further Details:      
 
Domain Number 2 Region: 363-456
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.77e-21
Family Thioltransferase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 41431.PCC8801_2343
Sequence length 461
Comment (Cyanothece PCC 8801)
Sequence
MVSSTVENLVIIGSGPAGYTAAIYAGRAKLKPFLFEGLKAGGIRGGQLMTTTEVENFPGF
PEGITGPDLMDRMRAQAERWGAQCYTEDVVEVDLRQRPFKIRSTEQEVYAHSLIIATGAT
ARRLGIASEQEFWSRGISACAICDGATPLFKDEELAIVGGGDTACEEALYLTKYGSHIHV
LVRREEMRAGKIMQNRVLDHPNITVHWNTEILDGIAKGGKLVGLTTRNTQTGETGELAVK
GLFYAIGHTPNTELFKGQIELDEEGYILVKPGTVETNVEGVFAAGDVQDSNYRQAVTAAG
TGCMAALVAERWLSHNNLIQEDQQTPEKEEYEYKDESGTGLVADTEETFDISKTRHVGGY
ALRKLFHESDRLILVKYVSPVCGPCHTLKPILNKVVEEYDGRIHYVEIDIEADPEIAKNA
MVTGTPTVQFFKDKEIVEQLLGVKQKSQYRQVIDKYVPATV
Download sequence
Identical sequences B7K2G5
gi|218247143|ref|YP_002372514.1| 395962.Cyan8802_2394 41431.PCC8801_2343 gi|257060214|ref|YP_003138102.1| WP_012595626.1.62203 WP_012595626.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]