SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 415426.Hbut_0108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  415426.Hbut_0108
Domain Number 1 Region: 95-244
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.62e-21
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0048
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000107
Family Ferredoxin reductase FAD-binding domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 415426.Hbut_0108
Sequence length 257
Comment (Hyperthermus butylicus)
Sequence
MQRYSYHSVELVRILWRGPRQVMLEYRYLDSAPSLSPGQFILFWVPGSEAIPLTPLYSDA
SRLVLLVVERGPTTARLVSSPPRHAGVIAVLGRRFTYRGDEMVFLAGGVGVAAVAMAARE
AAQSGVRVTVFYGARSAGELAPVEEFLGGARVIYATDDGSRGLRGTVLDALHASGLRVGD
VYTVVAGPKPLLCRAYSEAAEAGQLERLALSIETMVRCGLGFCGSCTIPCTGMLLCRDGP
VVPAVRLGCWVVRECQN
Download sequence
Identical sequences A2BJ22
WP_011821300.1.50451 415426.Hbut_0108 gi|124027008|ref|YP_001012328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]