SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 415426.Hbut_0126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  415426.Hbut_0126
Domain Number 1 Region: 16-202,327-408
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.43e-54
Family Bacterial dinuclear zinc exopeptidases 0.0019
Further Details:      
 
Domain Number 2 Region: 205-319
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.89e-19
Family Bacterial exopeptidase dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 415426.Hbut_0126
Sequence length 409
Comment (Hyperthermus butylicus)
Sequence
MRVLDETDARTLHSYIIDLYKSFIPVKAIPPDMGGEGELERAKVLEDELRRLGLRVWRVD
ARDERARGGIRPNILAQLEGADTSRTLWIVAHMDTVPEGDRSLWRYEPYSVTVEDDYVYG
RGVEDNGQAIVVAFAVAKYLVERGVKPRVNLGIALVSDEETGSRYGLQYLLSQNVFGTPE
SNWFLVPDAGSPDGSKVIVAEKHILWFKIRVVGMQAHASTPHEGINAHRLGMMFNLELDR
ILHTRFTRYDPIFEPPVSTFEPTRKEENVSNINTIPGVDTVYWDARILPSYSIDEVVETV
KSTAYSFASSHGIKVEVEIVARDDAGEPTSPDHPFTRAFLRAIREARNVEPKLLGIGGGT
IARYLRKKGYPALVWMTCEETAHKPNERARLSSILADVDTVLYYLLHVA
Download sequence
Identical sequences A2BJ40
415426.Hbut_0126 gi|124027026|ref|YP_001012346.1| WP_011821318.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]