SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 415426.Hbut_0243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  415426.Hbut_0243
Domain Number - Region: 424-462
Classification Level Classification E-value
Superfamily Prefoldin 0.00207
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 415426.Hbut_0243
Sequence length 473
Comment (Hyperthermus butylicus)
Sequence
MAAYWFTAGLAALNYAYRLLGRRRLVAYIVAAAAMLAVALGLASLYAPVAASRHVEVMSL
DEPIDVNGLKCFIPLMTAYAYASGRIQIPTHRVYSEDSYVYYLGNHSVYNWIIEPEGFWN
HLTKKPLGVVFVYGDEYPPHVEVVEKPLEWGLHSKVFRLLFFDTLERRIVLAAGLRYKPL
LEDNIEILHEERIYILVPLVTWKRGLLYSIPILYGYAVVDEDGGIEVVEKDRLASDPRFQ
GMPLLPEAIARSWVEAYRYRVGLIEFYLHHNTYVIRDIGTNPQPYLEQGADSRLYWVFVA
EPPGETYSTRYIIYVEASHVEGLQLLFYEFPEPVIGISKVESYIKQAHPIYDWGELSIEE
PMLTMLNGTLYWKATVTTKDYRGLVAVDIVNAATSEITSLQPRRHITYLDALQAILGHMA
IEEHPAKSLEERINTLEHRIAEVIKTLEEIQQELQELQRMVSNTTASTGEPPR
Download sequence
Identical sequences A2BJF4
gi|124027140|ref|YP_001012460.1| WP_011821432.1.50451 415426.Hbut_0243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]