SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 415426.Hbut_0248 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  415426.Hbut_0248
Domain Number 1 Region: 22-213
Classification Level Classification E-value
Superfamily vWA-like 5.7e-17
Family Integrin A (or I) domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 415426.Hbut_0248
Sequence length 263
Comment (Hyperthermus butylicus)
Sequence
MAIPSTMLRVLKRRPLSYTVLVIFMLDRSLSMSELKTYDHRSKWEHLVELVERLLARLAR
SNMAPAFRVGFVWFSDDVKVVERGGAVYFPVTEHNPALRVFQESTEENRPYGMTAMADAL
EHAAMIIERYIEDTSIPSEKYVTVFMFTDGKETKRTPEDVVEVADRITGELQEKLRALNQ
RNRIGLATIALGLDADRETLRTIASFLREAQRRVLEERGLIDLVDPPYHEKMFIDAPRND
KITREWEEAVRRFVERLSETAIF
Download sequence
Identical sequences A2BJF9
WP_011821437.1.50451 415426.Hbut_0248 gi|124027145|ref|YP_001012465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]