SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 415426.Hbut_0598 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  415426.Hbut_0598
Domain Number 1 Region: 18-62
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000759
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 
Weak hits

Sequence:  415426.Hbut_0598
Domain Number - Region: 63-103
Classification Level Classification E-value
Superfamily Prefoldin 0.000379
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 415426.Hbut_0598
Sequence length 110
Comment (Hyperthermus butylicus)
Sequence
MFGYWYRWMRRLVYYAPPPPPPPPLPLQQQQSQQQQYPYQYPPYPYYPPIPPYPYYMPPI
PQSPEEELEMLEEYKKMLEEDLKELQEELKSVEERIRELREIIRHRSSKA
Download sequence
Identical sequences A2BKE6
gi|124027482|ref|YP_001012802.1| 415426.Hbut_0598 WP_011821775.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]