SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 415426.Hbut_0817 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  415426.Hbut_0817
Domain Number 1 Region: 6-86
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000389
Family GHMP Kinase, N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 415426.Hbut_0817
Sequence length 119
Comment (Hyperthermus butylicus)
Sequence
MTVSRVRVKAPSSIANLGVLFDLAALAVSYAYDTVTVEVVGRQSSEPRVEVEAVGAPSGE
SNTAYVAARKLLEYLDEKLHVRILLRRAYRPAWVSGVVVLQRQPRCTLSTRSLVVLSSR
Download sequence
Identical sequences A2BL09
gi|124027695|ref|YP_001013015.1| 415426.Hbut_0817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]