SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 419665.Maeo_1267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419665.Maeo_1267
Domain Number 1 Region: 5-252
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 5.49e-126
Family Methyl-coenzyme M reductase gamma chain 0.000000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 419665.Maeo_1267
Sequence length 260
Comment (Methanococcus aeolicus Nankai-3)
Sequence
MAYTPQFCPGSTTVAQNRRDHMNPDVQLEKLREIPDDEIVKVMGHRQPGEDYKTVHPPLE
EMDMPEDFVRDIVEPMSGAKEGHRIRYIQFADSMYNAPAQPYDRARTYMWRFRGVDTGTL
SGRQVIEMRESNLEEMSKNFCIDTAFFDPATCGMRGATVHGHSLRLDENGLMFDALQRYV
FDEKTGHVLYVKDQVGRPLDEPVDFGEPLSTEKLKEITTIYRKDSIAMRDDEEIVTVVKR
IHRARTLGGYMPTEKIFEGL
Download sequence
Identical sequences A6UWH1
gi|150401689|ref|YP_001325455.1| 419665.Maeo_1267 WP_011973975.1.55018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]