SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 419942.YN1551_2795 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419942.YN1551_2795
Domain Number 1 Region: 42-161
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000509
Family GHMP Kinase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 419942.YN1551_2795
Sequence length 270
Comment (Sulfolobus islandicus Y N 15 51)
Sequence
MRLKSQLLLVKIINNNFIVLGVEIKVPVSISGMWYPVIDRENLFESGSIGLTLTLEPYIT
AEIRGGSGIEFNGIEIKLPNYDILKKKLGEYRLSVYSEVPLGYGYGLSGAISLAYALGVK
ELAPISEKDAVNVAHLSDVIAGNGLGDVIAQYYGGGLVYRKKAGGLGYGEVEIINMDWSQ
YPIFSQPISHLPTKSIIKRSEIALKLIDEFLKNPSPLKFIEVAQKFTSSLGFNSEYPYSY
RKKGIIVKIFDPEYGVWIKHKIASRGAYVT
Download sequence
Identical sequences C3MK77 C3NMB7 D2PEN7
gi|227829241|ref|YP_002831020.1| 419942.YN1551_2795 429572.LS215_0220 gi|284996596|ref|YP_003418363.1| WP_012712858.1.34992 WP_012712858.1.52267 WP_012712858.1.66823 gi|229583222|ref|YP_002841621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]