SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 425104.Ssed_1611 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  425104.Ssed_1611
Domain Number 1 Region: 134-558
Classification Level Classification E-value
Superfamily Subtilisin-like 1.16e-97
Family Subtilases 0.00000000000506
Further Details:      
 
Domain Number 2 Region: 690-801
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-21
Family Proprotein convertase P-domain 0.028
Further Details:      
 
Domain Number 3 Region: 48-130
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000232
Family Subtilase propeptides/inhibitors 0.0042
Further Details:      
 
Domain Number 4 Region: 607-671
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000981
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 425104.Ssed_1611
Sequence length 802
Comment (Shewanella sediminis HAW-EB3)
Sequence
MTVRQFTTSALSLSVLAIAISATVQAAPTFTQGIQSLKSDSKQASPLPKRYIVNFKSSIQ
SEGDEISGLSYEAAQNEVLSQHKALNSVSAKEMKRIGRSNSYTVKLDKAGIDSLKKRGDV
DYVEEDMQRHFLSETTPWGQTYVGATSLSDSQAGNRTICIIDSGYDRSHNDLSGNNVTGT
NNSGTGNWFEPGNHNAHGTHVAGTIAAIANNEGVVGVMPNQNANIHVIKVFNEAGWGYSS
SLVSAVDTCVDNGANVVTMSLGGSSSSTTEKNALTAHQDNGILLIAAAGNDGDNTHSYPA
SYDAVMSVAAVDNNKDHAAFSQYTNQVEIAGPGEAILSTVTLGEGRLADITIGGQSYFDN
GVVPHNRYVKSGTDHVATPISGSVMGELAECSVSGSTFNCGDMNSKVCLVERVGNQGAGY
PEIDAVRACNNAGASAVIVYGNPALPGLQNPFLVDTNNEAAIVSVSVDRATGQALQAQVG
STVTVENTANEDYEYYNGTSMATPHVSGVATLVWSHHTECGAAQIRAALNATAEDLETAG
RDDKTGYGLIDAVAADTYLDASCDGPVDPGTGTGTGGAELQNGVTKTDLAGAKNEELHFS
LDVPAGATDLSFTMSGGSGDADLYVQYGAAPSTSSYDCRPWKTGNSESCPITTTESGTYY
VMVQGYSAFSGINLVANYTEATGGNTGGVASYTNTNSYSIPDNKAAGISSPISVSRSGDA
GTVSVTVNITHTYIGDLQVELHTPSGEVAILHDNTGSSTDNINQTYTVDTTGIESAGEWK
LKAVDSGRRDTGSIDSWEISFQ
Download sequence
Identical sequences A8FTP9
WP_012141958.1.70442 gi|157374750|ref|YP_001473350.1| 425104.Ssed_1611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]