SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 427317.M1425_0170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  427317.M1425_0170
Domain Number 1 Region: 75-159
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00018
Further Details:      
 
Weak hits

Sequence:  427317.M1425_0170
Domain Number - Region: 16-61
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0964
Family Eukaryotic type KH-domain (KH-domain type I) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 427317.M1425_0170
Sequence length 186
Comment (Sulfolobus islandicus M 14 25)
Sequence
MFTTVEDEKLEVVKKIIEKLEQFTDTKIMYDERTKTFNILPKGQNQYEAFKAVSVIRAIG
LGFDEQSAFRLLSDEYILDVIDLKTLIGSNPDAIRRVKGRIIGEGGKAKRIIQEYTGVDI
SIYGHHIGIIGPYDQVQIARKAIELLIDGKEHSSVYKFLDKAEKDLIIYKTSKLGRKGIN
EIKSNR
Download sequence
Identical sequences C3MU27 C3N0N9
427317.M1425_0170 427318.M1627_0170 gi|229583744|ref|YP_002842245.1| gi|227826580|ref|YP_002828359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]