SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 434922.CBUD_1299 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  434922.CBUD_1299
Domain Number - Region: 319-392
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0418
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 434922.CBUD_1299
Sequence length 734
Comment (Coxiella burnetii Dugway 7E9-12)
Sequence
MRRKKESSERLSKRNKVPVTLKELRARLSELEQWIAQEKKLVDFPNIWSFLEGKVEEGEW
EGVNGFWLMVYEGLRGKATLLEALAVYLEGPAKNDINASHLKASPRGEDREAGENVLCLI
ACAAGKRHPAMLNALVDQVKDLPSEDLLLLLKETAKGRNVAGVNTLWLIACAAVKGHPAM
LNALADRIKELSIEHLPLLLKETAQEAEGARRNTLWVIACAASHGHSAMLNALSDGVKKL
SAQDLLLLLKETAQAGGATGQNTLWEIACAAVNGHAAMLNALAGRIKELSKELSIEKLWL
LLKETAQAGGDAGRNTLWLIAWAAVKGHPAMLNALADRIKELSIENLLLLLEETAQAGDA
TGHNTLWLIAWAAVKGHPAMLNALVMHIKNLKPEEISDLLQKRPEGGVMAGENGLRLIVK
VAQSGHVEMLNAVAKKLMQLPRDKRSKLLTPEPENSTFEMLISVAARELKTQEFELLLPD
CFTDQFDLPASEDNYMQKIFPLMKEVNELISTPQASVESLEENEEPTVINPVDKQKLEFI
LDQVTQIETTKAKTNLLSFILFKLQHRINPTFMIKILVPLIRTEPKYSNNPQIKQLYLEN
KFSIITNIKNKRHEIESHLLDAFKVLKLGEESLDESLYSTLDHFIMQVFNYNQIGLDIDQ
AEKIRSHILAHCDQNVTALPYEIFTGMVITKAKDFLKTNSAPQRATRFGMFSLSGKQTEE
WLRDHDFSGEFELN
Download sequence
Identical sequences A9KFR4
gi|154707205|ref|YP_001424653.1| 434922.CBUD_1299 WP_011997025.1.29693 WP_011997025.1.43615 WP_011997025.1.99156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]