SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436017.A4RVK1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436017.A4RVK1
Domain Number 1 Region: 117-215
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000039
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436017.A4RVK1
Sequence length 250
Comment (Ostreococcus lucimarinus CCE9901)
Sequence
MTALDGDDDEATRATVMRGTTARGMARAVADALRETRRDAYYAETAREDGAKDAATIRVD
ARRVMIVEQRVAVRLMTKTSNGVLEAVAATGARATTTEASAEEDFDEREKRRIAITGPPE
SVQKCVELIESLVRETENRTSKRFFCPKAYLGAFIGRGYGHVHKIEGVSKCKIVISDEDK
VHEGNEHSVVRAIEVTGTPMQVSLGYKLALQTLDEALASAPDAEELKAELKETSGGFDLD
AERAKKKAKN
Download sequence
Identical sequences A4RVK1
XP_001417155.1.19716 jgi|Ost9901_3|92560|ost_04_004_052 436017.A4RVK1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]