SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436308.Nmar_0315 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436308.Nmar_0315
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-35
Family GHMP Kinase, N-terminal domain 0.00035
Further Details:      
 
Domain Number 2 Region: 171-310
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.64e-30
Family Mevalonate kinase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 436308.Nmar_0315
Sequence length 313
Comment (Nitrosopumilus maritimus SCM1)
Sequence
MKSKASAPGKVILFGEHFVVYGVKAILCAINKRIAVTAEKIDERKISIKSNIGHLELEPN
KPISEINSPLKPFYYLANKIIQDKNFGIKIDVESEIPLGVGLGSSSACCVAGAAAISNLF
ENNSKEEILKLAIEAEKTIFQNTSGADCTVCTFGGLMEYDKENGFSKIESEPNFHLVIAN
SNVEHSTESVVAGVRKFKKNNEAEFSKLCKDESHLIENVLELLKENNIRELGERVIKNQE
YLERIGISNAKLREMIQTGQNSSFGAKITGAGGGGCIFALTDESNLENTIKEFKEKNHEC
FSVKIDFKGLDTF
Download sequence
Identical sequences A9A427
436308.Nmar_0315 gi|161527823|ref|YP_001581649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]