SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436308.Nmar_0395 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436308.Nmar_0395
Domain Number 1 Region: 5-134
Classification Level Classification E-value
Superfamily Prefoldin 1.19e-20
Family Prefoldin 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 436308.Nmar_0395
Sequence length 145
Comment (Nitrosopumilus maritimus SCM1)
Sequence
MSQEQAEQLMQQMQMLETYFADLSQRENTFLGVFREATAAIESIKSLSKNPESDTLVPIG
LGTYVPTKISSDSKIILNIGAGVAVEKDFPSAINYLEERIKEIEIAIQDTAAKKQDAAQR
LEQGKAQVNQLMQAMQQSGQPPKSG
Download sequence
Identical sequences A9A592
436308.Nmar_0395 gi|161527903|ref|YP_001581729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]