SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 436308.Nmar_1718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436308.Nmar_1718
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-18
Family GHMP Kinase, N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 436308.Nmar_1718
Sequence length 303
Comment (Nitrosopumilus maritimus SCM1)
Sequence
MKGVAFCPAHITGFFKAHLENNQEKLENLGSMGAGFSIRQGVTTKVTIDKKNNHDSNFKI
ITKGYQSDKTDVSEFVLNEFLKIGNFEDKFFNIEHEISIPVGYGLGSSSAVALSLSFALD
QALNTKLDKNTIGQIAHNAEVNCKTGLGDVLASFHGGFEVRVKPGAPGIGTVEKISTDKI
SVIMICFSPISTNKFIKERLSQINGLGGKMVNRLLESKDYQHFQDMSLEFAKYVDVMTPR
MQKIVNELTQNDIKCGIALFGETIFSMIPKEDESKVLKILEKYSDGVIINSELDNIGARV
LNN
Download sequence
Identical sequences A9A2T7
436308.Nmar_1718 gi|161529226|ref|YP_001583052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]