SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 439386.YG5714_1827 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439386.YG5714_1827
Domain Number 1 Region: 11-248
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.6e-76
Family Pseudouridine synthase II TruB 0.000000354
Further Details:      
 
Domain Number 2 Region: 251-331
Classification Level Classification E-value
Superfamily PUA domain-like 1.99e-18
Family PUA domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 439386.YG5714_1827
Sequence length 339
Comment (Sulfolobus islandicus Y G 57 14)
Sequence
MILNDFIYKIDNFCGYKNEWKIRKDSETSDTYGYYPEKRPIDVHIKNSIINLDKPPGPTS
HEVAYWIKKMLNVNKAGHGGTLEPKVTGVLPIGIENATKIMNYISKGGKEYVCVMQVHCE
YDKEELTKIIKSFEGEIYQRPPVRSSVKRRLRVRSIYDIEILDMDKKLVLFRVSCDSGTY
MRKLCHDIGIIYGCGAHMRELRRTRSGIFTESTNLVKLHDLSEAIYLYKNCKDETELRRV
LMPMEYATCEMPKLIIEDSAVNALAYGAQLAVPGIVAYQNFKRNDTVAVLTLKGELVATG
NALIDSKELENAKKGIVVNLSRVFMQRDIYPKAWKKHES
Download sequence
Identical sequences C3MXC6 C3MZ70 C3N790 C3NGE5
gi|229585245|ref|YP_002843747.1| gi|227827978|ref|YP_002829758.1| gi|229581728|ref|YP_002840127.1| 419942.YN1551_1098 427317.M1425_1711 427318.M1627_1827 439386.YG5714_1827 gi|229579607|ref|YP_002838006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]