SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 441772.CLI_0451 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  441772.CLI_0451
Domain Number 1 Region: 562-659
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000119
Family Collagen-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 442-538
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000034
Family Collagen-binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  441772.CLI_0451
Domain Number - Region: 350-431
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00719
Family Collagen-binding domain 0.0078
Further Details:      
 
Domain Number - Region: 97-154
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0669
Family Aminoacid dehydrogenase-like, C-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 441772.CLI_0451
Sequence length 673
Comment (Clostridium botulinum F Langeland)
Sequence
MVKSKEKNKIFFTLLVITLIFIVNSNKVKANDEINFKRLYGKERYETSASICSGGWETAE
YAVLASGEGFADALSAAPLAKKYDAPIILTGKNKLNDNAKDQLKKLDTKEVIIVGGPGSI
SEDIATELKNLGIKVNRIYGEDRYKTSLKIAKEIGVKNGVVVTNGLGFADALAMAPIAAS
KQMPILLTPSDKLTSDTMEFLTKSSYNKSYVLGGTATVSDYIKNSLKNPTRLSGDDRYKT
NIAILSHFKQDLNLNEVYITSGDGYADALSGSVLASKNKSPIILINDNLNKSTKDFVSTN
KFDFKNVTIFGGEGVVKEPTISSLFGAFRSGETRSDTKEVVAERWDRSYLKDYHIDLPKE
GKLDIEYDFNDFTRFDLIVLDKKGNEIIKKSYNYLNKNKSIHDNYNDIRLPKGSYIVRVH
AFNMNGTYTIKAKYTQEGEGFEKEFNNDIKTANLIEPNKSIIGSIHSYNDVDYYKFTLNE
KGSLKINLKHNQYGRYGFRVSLLDENNKSITEFISGGEDINSYSNKLRLAKGTYFVKIEC
EKWNDEPLQYELNLVYNIEGENYESEPNDYIQDANYIKCNKEYIGNIQSRDDRDYYKINL
NSDSKITINFKHDEGYGKWTILLCDKDNNPIRRFKSYGYEINKDFGPIELKEGEYYVSIE
GKDDLDYTINILK
Download sequence
Identical sequences A7GAD7
gi|153939264|ref|YP_001389747.1| 441772.CLI_0451 WP_011987399.1.24613 WP_011987399.1.68062 WP_011987399.1.96435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]