SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 444157.Tneu_0246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  444157.Tneu_0246
Domain Number - Region: 16-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0152
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 444157.Tneu_0246
Sequence length 62
Comment (Thermoproteus neutrophilus V24Sta)
Sequence
MEIPQELKSYLAVEADQWDVKHIVCLKCRKKFFTVRDAALHLHAVHGLKAAQKYISASHG
QA
Download sequence
Identical sequences B1YB68
444157.Tneu_0246 gi|171184726|ref|YP_001793645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]