SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 444177.Bsph_2533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444177.Bsph_2533
Domain Number 1 Region: 959-1071
Classification Level Classification E-value
Superfamily Collagen-binding domain 9.68e-29
Family Collagen-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 856-957
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.44e-24
Family Collagen-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 737-847
Classification Level Classification E-value
Superfamily PKD domain 3.14e-20
Family PKD domain 0.0011
Further Details:      
 
Weak hits

Sequence:  444177.Bsph_2533
Domain Number - Region: 599-634
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0942
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 444177.Bsph_2533
Sequence length 1072
Comment (Lysinibacillus sphaericus C3 41)
Sequence
MKKKFTFNQLLIGVSTMAISLGGLQAEASAAEKTPYNVLQMKPIGIEMPKDEMVHSTMAE
ETLSYEERLEIGDFSQRPAPTLERMDTQQLQEQYSMAELNKMSDRELIHTLGNIRWFQIT
DLFQFNDDTKAFYQNEERMQVIINELGNRGSSFTKDDSKGIETFVEVLRSAFYVAFYNNE
LGYLNERSFHDKCLPALKAIANNPNFKLGTDEQDKVVSSYGKLISNASSDVETVQYATKI
LKQYNDNLSTYEAENSKGQAIYDLIQGIDYDLQSYLYDTRKEANTTMWYGKIDGFIEEVN
NIALIHNVTDNNSWLINNGIYYAGRLGQFHSKPDKGLEVVTQAMHMYPYLSEAYFVAVEQ
ITTNYGGRDLHGNTVDLQKVREEGKKQYLPKTYTFDDGSIVFKTGDQVTEDKIQRLYWAA
KEVKAQYHRVIGNDKALEPGNADDVLTVVIYNSPDQYRLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEYTHFLQGRFEVPGLFGTGDMYQNERLTWFQEGNAEFFA
GSTRTNDVVPRKSIISGLSHDPSQRYTAEQTMFAKYGSWEFYNYSFALQSYMYTHQFDMF
DRIQDLIRANDVKNYDDYRESLSKDSQLNMEFQAYMQQLIDNQEKYEVPQVAEDYLMQHE
PKALNEVQQEIVDMAQLQDAKMTKHQSQFFNTFTLEGTYVGSATQGESQDWKTMSKQVNQ
VLDQLSKKEWSGYKTMTAYFVNYRVNAANQFEYDVVFHGVSTDEGETQAPIVNINGPYTG
MTHESIQFKSDGTKDKDGEIVSYLWNFGDGTTSEVANPTHVYEKEGTYNVTLTVKNNKGL
ASKGQTIATVRKGGQTEQEQATIIPFNKPLKGSLIDNDTNVYQFDITSPEELDISVVNEN
QIGMTWVLYHESDMQNYVAYGQEDGDTIKGKFNAEPGKYYLYVYKFDNKNGTYTVQVQND
TKAEIEPNNRPEEATILPFNTPLKGRLMDDDHTDVYEFNVTSPKELDISVLNENRIGMTW
VLYHESDSQNYASFGQEEGNMINGKLHAEPGKYYLYVYKFENENGTYTVQVQ
Download sequence
Identical sequences B1HXW1 W7SCF9
444177.Bsph_2533 WP_012294172.1.18114 WP_012294172.1.47961 WP_012294172.1.54975 WP_012294172.1.60952 WP_012294172.1.93816 gi|169828058|ref|YP_001698216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]