SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 446462.Amir_4533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  446462.Amir_4533
Domain Number - Region: 5-319
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000165
Family Gtf glycosyltransferase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446462.Amir_4533
Sequence length 360
Comment (Actinosynnema mirum DSM 43827)
Sequence
MSIAVLTSGVALGVHVPGLLLARRLAELGVAARVDVLENHLPERTRELIPASKVAFHRDF
RVALAGQRLAARNTTEPDEELVAGLWREWERDGVELLVVLSGFWLPTAHRYALAHDGVRV
RSCHVDSVASPSFTSASGAGRGSWAEHEDVWLLERAGSAVARTIPVSREEPAPWGDRDGR
VLAHGGGWGMGTYRTGAAELGAAGFALDVVAYERSEVPEEQGRNRYFMIDPDWHPWHDTG
FPPFGRVRDGEVGYRRRAEHHDGFDLTRRAIAVVSKPGGGTLMDSLSAATPVVLLEPFGA
HEARNAELWRDLGFGIGYREWVDGGRRVAVLEALHRNLVAARGRVLSYPDELALKWPEGR
Download sequence
Identical sequences C6WLI3
gi|256378562|ref|YP_003102222.1| 446462.Amir_4533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]