SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 446471.Xcel_1065 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446471.Xcel_1065
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.55e-30
Family Thioltransferase 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446471.Xcel_1065
Sequence length 123
Comment (Xylanimonas cellulosilytica DSM 15894)
Sequence
MATVELTDDTFRETVEGNDIVLVDFWATWCPPCRQFGPVFEKSSETNPDVVHGKIDTDAQ
QRIAAAAGITSIPTLMAFREGVLVFSQPGALPAPALQQVVDAVKALDMNEVREAIEAEAA
GSN
Download sequence
Identical sequences D1BZE2
446471.Xcel_1065 gi|269955865|ref|YP_003325654.1| WP_012877838.1.53538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]