SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 446471.Xcel_2130 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446471.Xcel_2130
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.96e-46
Family Glutathione peroxidase-like 0.0000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446471.Xcel_2130
Sequence length 152
Comment (Xylanimonas cellulosilytica DSM 15894)
Sequence
MALQPGEPAPDFTLQDTHGTPVHLADLLADGPVLLVFFPFAFSGICTGELCELRDNIEDF
ETAGVRLVAVSTDPVFTLKAWQQVEGYTFDLLSDFWPHGAVARAYGVLDEQNGHALRGTF
LIDAGGVVRWSVTNPRGQRRDLQAYRTALAEI
Download sequence
Identical sequences D1BUD5
gi|269956917|ref|YP_003326706.1| WP_012878890.1.53538 446471.Xcel_2130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]