SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 446471.Xcel_3453 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446471.Xcel_3453
Domain Number 1 Region: 1-71
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.89e-18
Family Thioltransferase 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 446471.Xcel_3453
Sequence length 81
Comment (Xylanimonas cellulosilytica DSM 15894)
Sequence
MSITVYSKPACVQCEATYRALDKKGLEYTVVDITQDATALETVRALGYLQAPVVVTEVTH
WSGFRPDQINALALAQGTPTP
Download sequence
Identical sequences D1C0Y6
446471.Xcel_3453 gi|269958222|ref|YP_003328010.1| gi|269958222|ref|YP_003328010.1|NC_013531 WP_012880192.1.53538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]