SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 44689.DDBDRAFT_0190592 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  44689.DDBDRAFT_0190592
Domain Number 1 Region: 5-156
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-23
Family Calponin-homology domain, CH-domain 0.00083
Further Details:      
 
Weak hits

Sequence:  44689.DDBDRAFT_0190592
Domain Number - Region: 122-242
Classification Level Classification E-value
Superfamily Porins 0.0302
Family Outer membrane protein transport protein 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 44689.DDBDRAFT_0190592
Sequence length 446
Comment (Dictyostelium discoideum)
Sequence
MDYEILLNKQRSVKIWIEFILGINLGDVNVFDAIRDGRLLCKIMNSFHDRIDYIHYSNVV
PVSPFKRTENINLFLKKCRLYLPPESLFNINDLEKNEKPELVLDCLIQLSEYFLQNRIPP
GNASENGSNEDGFPSDDLSYYDNNGNIINNNNNNYNNHNNNNNIFYNINNNNHNNNNHNH
NNNNNNNNNNNNNNNNINNYNKNNNNNNNNNNNNNNNNNNNNNDNLNNSSSSNSSNQFID
ENENEKNNYQYQFQYLQHQQFLYQQQQLLIEQQQRLQQQQQQHQLKLRQQQQQQQQQQQQ
QLQGEEEEQDGNQENYEQDNDQIQENLEYGEDGEINNESENRAVPFKKGMNGHILDCILE
VKHYVLVPLFISVAAGFGIKMGRSIFVNMVDFNYSLFFTRSYSHVSTIITNKLAHSLSSL
PSITFKDITNVLNSFIDYTKDNLLKK
Download sequence
Identical sequences Q55D11
DDB0307435|DDB_G0269824 44689.DDBDRAFT_0190592 XP_646320.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]