SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 447217.AnaeK_4241 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  447217.AnaeK_4241
Domain Number 1 Region: 17-211
Classification Level Classification E-value
Superfamily Nudix 7.14e-30
Family MutT-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 447217.AnaeK_4241
Sequence length 219
Comment (Anaeromyxobacter K)
Sequence
MRAPGFDEATERVRRALAARPRRALAVPGFRPAAVLVALLDRAGGPSILFTRRSQALEHH
RGEISFPGGRLEPGEDARAAALREAHEEVGLAPAASEVLGLLDDLPSVAGYVVTPVAASV
RAPPAAFTASAGEVDEHFELPLAQLLDPALRRASLWDPAGLPERLAAVVARAAVPFEDVD
PGTGHWRVWSFHADEARVVWGLTARILADLLDRAFAARG
Download sequence
Identical sequences B4UI30
WP_012528196.1.49349 gi|197124622|ref|YP_002136573.1| 447217.AnaeK_4241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]